Oct 29, 2024

Public workspaceDengue virus serotype 1 NS2B-NS3 protease fusion construct small scale expression and purification protocol V.2

  • 1Centre for Medicines Discovery, University of Oxford
  • ASAP Discovery
Icon indicating open access to content
QR code linking to this content
Protocol CitationKorvus Wang, michael fairhead, Eleanor Williams 2024. Dengue virus serotype 1 NS2B-NS3 protease fusion construct small scale expression and purification protocol. protocols.io https://dx.doi.org/10.17504/protocols.io.q26g71qw8gwz/v2Version created by Korvus Wang
License: This is an open access protocol distributed under the terms of the Creative Commons Attribution License,  which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited
Protocol status: Working
We use this protocol and it's working
Created: October 18, 2024
Last Modified: October 29, 2024
Protocol Integer ID: 111190
Keywords: expression, purification, ASAP, CMD, AViDD, Dengue Virus, Dengue Virus NS3 protease, NS3 protease, Dengue 1, DENV1 NS2B-NS3 protease
Funders Acknowledgement:
National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)
Grant ID: U19AI171432
Disclaimer
Research was supported in part by NIAID of the U.S National Institutes of Health under award number U19AI171399. The content is solely the responsibility of the authors and does not necessarily represent the official views of the National Institutes of Health.
Abstract
This protocol details the co-expression and purification of Dengue virus serotype 1 NS2B-NS3 protease fusion construct bearing a N-terminal His-StrepII tag at small scale (<6L).
Attachments
Guidelines
  • Construct / plasmid resource-name: DENV-1 NS2B-NS3 protease fusion bearing a TEV-cleavable N-terminal His-StrepII tag.

Materials
Plasmid details:

  • Vector: pNIC
  • Cell line: E. coli Rosetta strain BL21(DE3)-RR
  • Tags and additions: N-terminal His-StrepII tag
  • Construct protein sequence: ` MHHHHHHSSGASWSHPQFEKGGGSGGGSGGSAWSHPQFEKGSGVDLGTENLYFQSMADLSLEKAAEISWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTGGGGSGGGGSGVLWDTPSPPEVERAVLDDGIYRILQRGLLGRSQVGVGVFQEGVFHTMWHVTRGAVLMYQGKRLEPSWASVKKDLISYGGGWRFQGSWNTGEEVQVIAVEPGKNPKNVQTAPGTFKTPEGEVGAIALDFKPGTSGSPIVNREGKIVGLYGNGVVTTSGTYVSAIAQAKASQEGPLPEIEDEVFRK

Expression
TB media, 0.5mM IPTG

Purification
Chicken hen egg white lysozyme
Benzonase
Imidazole
Ni Sepharose 6 FF resin
Gravity flow column, 2.5cm diameter
Centrifugal concentrators, 10kDa MWCO

On an FPLC system:
Cytiva HiLoad 16/600 Superdex 75 pg
5mL sample loop
HiPrep 26/10 desalting column

SDS-PAGE sample buffer, gel, and gel tank

Lysis buffer:

AB
Hepes (pH 7.5)50 mM
NaCl500 mM
Glycerol5%
TCEP1 mM
Lysozyme0.5 mg/mL
Benzonase0.05 mg/mL
Prepare 100L per 1L E.coli expression


Base buffer:
AB
Hepes (pH 7.5)50 mM
NaCl500 mM
Glycerol5%
TCEP1 mM
Prepare 2L per 6L E.coli expression. Used to prepare the following buffers
Binding buffer: base buffer + 20mM imidazole
Wash buffer 1: base buffer + 20mM imidazole
Elution buffer: base buffer, add 500mM imidazole
Gel filtration buffer: base buffer

SDS-PAGE gel: NuPage 4-12%, Bis-Tris protein gel, 27 well.
Run in MES buffer, 200V 35mins.







Abbreviations
Abbreviations
CV - column volume, total volume of resin in a column
IMAC - immobilised metal affinity chromatography
FT - flow through
D1VNS2B3 - DENV1 NS2B-NS3 protease
Plasmid Transformation
Plasmid Transformation
1d
1d
D1VNS2B3 N-terminal His-StrepII tagged fusion construct was inoculated from its BL21(DE3)-RR glycerol stock.

Note
The DENV-1 NS2B-NS3 fusion construct encodes the NS2B and NS3 protease with a N-terminal His6-StrepII tag fusion on a kanamycin resistant plasmid backbone with a T7 promoter.

Protein expression
Protein expression
2d 10h
2d 10h
Scrape off some of the glycerol stock with a sterile loop and use this to inoculate a 50 mL falcon tube containing Amount10 mL of LB supplemented with Concentration50 Mass Percent kanamycin. Grow the starter culture at Temperature37 °C DurationOvernight with 200 rpm shaking.
4h
Use Amount10 mL starter culture to inoculate every Amount1 L TB media (see Materials) supplemented with Concentration50 Mass Percent kanamycin in a baffled flask. Shaker200 rpm, 37°C

Note
For this protocol 2L of pellet was grown for purification

6h
Critical
When the OD600 approximately 1.8, add Concentration1 millimolar (mM) IPTG. Lower the temperature and shaker speed to Shaker180 rpm, 18°C . Incubate overnight.

1d
Overnight
Harvest the cell by centrifugation at Centrifigation4000 x g, 4°C, 00:30:00 . Discard supernatant and store pellet by freezing at Temperature-80 °C .

30m
Protein Purifcation
Protein Purifcation
2d
2d
Lyse cell pellet
2h 30m

Note
See Materials tab for buffer compositions.


Note
DENV1 NS2B-NS3 His6-StrepII fusion protein properties

Before tag cleavage:
MW = 31606.8 Da
E (assume all Cys reduced)= 52940 mM-1cm-1
PI = 5.29

After tag cleavage:
MW = 25912.8 Da
E (assume all Cys reduced)= 40450 mM-1cm-1
PI = 4.85

These values are determined by Expasy ProtParam


Thaw and resuspend the pellet in ~7mL of lysis buffer per g of pellet. Stir gently with magnetic stir bar at TemperatureRoom temperature for Duration00:30:00 to allow lysozyme and bezonase to start breaking down
cell components.
1h
Lyse by sonication Duration00:00:04 On Duration00:00:12 Off for a total 'on' time of Duration00:07:00 at 50% amplitude to fully rupture the cells. Ensure pellet is Temperature0 °C during sonication to prevent overheating.
7m 16s
Centrifuge the lysed cells for Centrifigation38000 x g, 4°C, 01:00:00 to remove insoluble cell debris, and collect supernatant in a bottle Temperature4 °C
1h
Perform IMAC to extract target protein from the lysed cell mixture
Dispense Amount5 mL Nickle affinity resin Ni Sepharose 6 FF - Cytiva into a gravity flow column. Equilibrate resin by first rinsing with ~ Amount10 undetermined distilled water, then ~ Amount10 undetermined binding buffer to remove the storage solution.
10m
Resuspend the equilibrated resin with some binding buffer and add to the supernatant bottle. Incubate the resin with the supernatant for Duration00:30:00 while rotating or otherwise mixing gently at Temperature4 °C
30m
Load the resin/supernatant mix back onto the gravity flow column, retaining the FT separately for SDS-PAGE analysis.

Note
For SDS-PAGE samples, mix 15uL sample with 5uL 4x sample buffer, supplemented with 10mM DTT.

30m
Wash the column with Amount10 undetermined of base buffer, followed by Amount5 undetermined of wash buffer twice. Allow wash buffer to pass through completely between washes. This is to remove non-specific, weak binding of contaminant proteins from the resin for a cleaner elution.
Collect washes separately for SDS-PAGE analysis.
30m
Elute the protein with Amount2.5 undetermined of elution buffer.
20m
Repeat step 8.5 one more time, collecting a total of 2 separate elution fractions. This is to ensure maximum retrieval of protein from the resin.

Measure the total protein concentration of the elutions by Nanodrop. Although still a mixture, A280 value can give an estimate of the protein content, which will determine how much protease need to be added to remove the affinity tag.
20m
Wash used IMAC resin with 10CV of base buffer, and leave in the column submerged in a small amount of base buffer such that the resin is kept moist.
This washed IMAC resin will later be reused for reverse IMAC (rIMAC)
Run SDS-PAGE of all samples from total lysis supernatant to final elution. Stain gel with protein staining solution Coomasssie Blue and determine which fractions contain the target protein by finding the band corresponding to the target molecular weight.

Note
The target protein is expected to be present mostly in the elution samples, although small amounts may be found in the FT and washes.
If that is not the case, then further troubleshooting is required.

40m
Elution de-salting, tag cleavage and reverse IMAC
1d
Pool and desalt the two elutions using HiPrep 26/10 deasalting columns, run on AKTA pure at the maximum flow rate of 10mL/min.

Note
This is to reduce imidazole concentration in the sample. High concentration of imidazole will inhibit protease activity during tag cleavage and removal.

30m
For tag removal, His-TEV was added in 1:50 ratio to the total protein content of the desalted sample, as determined by nanodrop. The mixture was left in the cold room at Temperature4 °C DurationOvernight

1d
In morning, pour the cleavage mixture over the washed resin three times and collect final FT.

Note
This step will remove the cleaved tag and any uncleaved target from the sample. If the protease used is His-tagged, then the protease is removed from sample too.


30m
Wash rIMAC resin with Amount2 undetermined wash buffer 1 and 2 to remove any target protein still bound to the resin.
Take samples of the FT and wash, characterise content by SDS-PAGE


SDS-PAGE analysis of IMAC and cleavage fractions. The band labelled in red, in rIMAC wash of cleavage round 2, agrees with the size of the cleaved fusion construct (25912.8 kDa)

30m
(Optional) elute rIMAC resin with Amount2 undetermined elution buffer to confirm if the protein shows non-specific binding to the resin used.

Note
This will help determine if the protein is "sticky" to the Ni resin matrix material, and help in further troubleshooting if the final yield is lower than expected.

5m
Purify sample further by size exclusion chromatography.
6h
Using 10,000 MWCO spin concentrators, concentrate the rIMAC step containing fractions of the target protein to a final volume of under Amount5 mL .

1h
Remove any solid aggregates from the sample by centrifugation at Centrifigation17200 x g, 4°C, 00:10:00 , then immediately draw up the supernatant with a 5mL syringe and a blunt-tip fill needle, taking care not to disturb the pellet.

Note
This is to remove as much solid particles from the injection sample as possible, so as to not clog the in-line filter or frit of the column.


15m
Using the AKTA Pure system:

Inject the sample onto a 5mL sample loop.

Run the sample down HiLoad 16/60 Superdex 75 pg gel filtration column at 1mL/min in gel filtration buffer, collecting 1mL aliquots.
2h
From the chromatogram, fraction D6-F10 were analysed by SDS-PAGE.

SDS-PAGE analysis of SEC fraction D6-F9. Fractions E2-E12 were pooled as they contain majority target protein in comparison to contaminants.

1h
Take the fractions that contain the target protein, which in this case are fraction E2-E12. Concentrate the final sample in Vivaspin 15 10kda MWCO centrifugal concentrator until the concentration reaches >Concentration10 mg/mL .

Take Amount1 µL of the final sample for SDS-PAGE. (not shown here)

Another Amount1 µL can be taken for mass spectroscopy (MS) analysis, which was not carried out here.

30m
Aliquot into appropriate volumes for future usage to minimise freeze/thaw cycles. Flash-freeze in liquid nitrogen, and store at Temperature-80 °C until required.
10m